Description: Delta-stichotoxin-Hcr1a (Neurotoxin 3) venom peptide is a recombinant peptide purified from Escherichia coli that was originally isolated from the venom of Heteractis crispa (Leathery sea anemone). This venom peptide binds to voltage-gated sodium channels (Nav), delaying their inactivation during signal transduction. Thus, it strongly stimulates mammalian cardiac muscle contraction. The recombinant peptide is provided in 50 mM NaHepes buffer, pH 7.5, 300 mM NaCl, at a 0.1 mg/mL concentration.
Sequence: GNCKCDDEGPYVRTAPLTGYVDLGYCNEGWEKCASYYSPIAECCRKKK
MW: 5386 Da
Number of Cys: 6
Number of Disulfide bonds: 3
Concentration: 0,1 mg/mL