Produkty
Producenci

Alpha-like toxin Bom4, recombinant venom peptide

nr kat.: VP0006
Cena brutto: do wyceny
ilość szt.

towar niedostępny

dodaj do przechowalni

Opis

Description: Alpha-like toxin Bom4 venom peptide is a recombinant peptide purified from Escherichia coli that was originally isolated from the venom of Buthus occitanus mardochei (Moroccan scorpion). Bom4 toxin binds voltage-independently sodium channels (Nav) and inhibits sodium channels inactivation, thereby blocking neuronal transmission. This alpha-like toxin was described as highly toxic to mice and insects. The recombinant peptide is provided in 50 mM NaHepes buffer, pH 7.5, 300 mM NaCl, at a 0.2 mg/mL concentration.

Sequence: GRDAYIAQPENCVYECAKNSYCNDLCTKNGAKSGYCQWLGKYGNACWCEDLPDNVPIRIPGKCHF

MW: 7296 Da

Number of Cys: 8

Number of Disulfide bonds: 4

Concentration: 0,2 mg/mL

Organism: Buthus occitanus mardochei

Pliki do pobrania

do góry
Sklep jest w trybie podglądu
Pokaż pełną wersję strony
Sklep internetowy Shoper.pl