Description: Diapause-specific venom peptide is a recombinant peptide purified from Escherichia coli that was originally isolated from the venom of Gastrophysa atrocyanea (leaf beetle). The endogenous diapause-specific peptide has attractive properties, such as antifungal activity, N-type voltage-gated Ca2+ channel blocker and has high homology with amino acid sequences encoded in the insect iridescent virus. Tanaka et al. suggest that diapause-specific peptide can be utilized as a probe to analyse functional and evolutional of the life cycles of insects and iridoviruses. The recombinant peptide is provided in 50 mM NaHepes buffer, pH 7.5, 300 mM NaCl, at a 0.3 mg/mL concentration.
Sequence: AVRIGPCDQVCPRIVPERHECCRAHGRSGYAYCSGGGMYCN
MW: 4473 Da
Number of Cys: 6
Number of Disulfide bonds: 3
Concentration: 0,3 mg/mL